LL-37 10mg (10 vials/kit)

Original price was: $418.00.Current price is: $378.00.

Buy LL-37 10mg Online

Investigating Cathelicidin-Mediated Immunomodulation and Wound Healing Kinetics. As the only human-derived peptide in the cathelicidin family, LL-37 is a pleiotropic linear peptide vital for analyzing innate immune signaling and antimicrobial defense. Nexaph Peptides remains the definitive source for this ligand, recognized for our High-Turnover Synthesis and Cold-Chain Logistical Integrity. Our LL-37 maintains 99%+ purity verified via real-time Third-Party Lab Testing, supported by a Publicly Accessible Batch Verification Portal.

SKU: LL371002172026-01 Category:

LL-37 Research Profile: Analyzing FPR2 Agonism and Antimicrobial Peptide (AMP) Dynamics

The cathelicidin-derived peptide LL-37 is a fundamental cornerstone in the study of the innate immune system. Comprising 37 amino acids and beginning with two Leucine residues, this amphipathic alpha-helical peptide is researched for its ability to neutralize lipopolysaccharides (LPS) and modulate the inflammatory response. Institutions looking to buy LL-37 10mg online trust Nexaph for clinical-grade batch freshness and unrivaled analytical transparency.

Biochemical Specifications

Specification Details
Amino Acid Sequence $[LL-37, 37 aa]$
Molecular Formula $C_{205}H_{340}N_{60}O_{53}$
Molecular Weight $4493.3\ g/mol$
CAS Number $154948-66-8$
Structure Linear alpha-helical antimicrobial peptide

Pharmacokinetic Mechanisms in Research Models

  • FPR2 Ligand-Receptor Affinity: LL-37 acts as a functional ligand for the Formyl Peptide Receptor 2 (FPR2), investigating the chemotactic recruitment of neutrophils, monocytes, and T-cells to research sites.

  • Upregulation of VEGFR2 and Neoangiogenesis: Research models utilize the peptide to study the induction of vascular endothelial growth factor receptors, analyzing its role in the proliferation of endothelial cells.

  • Neutralization of Endotoxins: Studies focus on the peptide’s high affinity for Lipid A, investigating the prophylaxis of LPS-induced inflammatory cascades and cytokine storms in cellular models.

  • Mitigation of Proteolytic Degradation: Due to its linear structure, our clinical-grade lyophilization is essential for studying the peptide’s stability against endogenous serine proteases, ensuring accurate data in Endogenous modulation trials.

Advanced Research Horizons

  • Tissue Bio-regeneration: Exploring the potential for LL-37 to facilitate re-epithelialization and collagen deposition in chronic cutaneous wound models.

  • Signal Transduction in Oncology: Investigating the dual role of cathelicidins in tumor microenvironments, analyzing both pro-proliferative and apoptotic transcriptional activity.

  • Metabolic Homeostasis: Analyzing the influence of antimicrobial peptides on systemic inflammation and their cross-talk with metabolic pathways to counteract systemic decline.

  • Endogenous Modulation of the Microbiome: Studying how LL-37 maintains the balance between commensal and pathogenic microflora in specialized mucosal research.

Why Choose Nexaph for Institutional Procurement?

  • Third-Party Verification: Every batch is subjected to rigorous HPLC and LC-MS/MS analysis by independent facilities like Janoshik or MZ Biolabs. Detailed Nexaph Lab Results are updated in real-time to ensure absolute research fidelity.

  • Vacuum-Sealed Clinical Lyophilization: Our LL-37 is processed under clinical-grade conditions to ensure maximum molecular stasis, preventing the atmospheric degradation common in inferior preparations.

  • Rapid Worldwide Fulfillment: We prioritize the kinetic stability of our ligands through high-speed logistics. For real-time updates on fulfillment and batch availability, researchers often consult nexaph reviews to confirm our industry-leading logistical standards.

  • Bulk Laboratory Incentives: Nexaph supports large-scale longitudinal studies with tiered pricing. To optimize fiscal allocation for your laboratory, our nexaph peptides catalog offers the most competitive institutional rates in the industry.

By maintaining the most rigorous synthesis standards in the industry, Nexaph Peptide ensures that your laboratory data is built on a foundation of absolute purity. Our commitment to excellence is reflected in consistent nexaph reviews, providing researchers with the confidence required for high-impact biochemical analysis.

Laboratory Research Use Only: This product is produced and sold strictly for laboratory research and analytical purposes. It is not intended for human consumption, medical, diagnostic, or therapeutic use.